Rabbit anti-Human SMARCC1/BAF155 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17178P

• Product Name:
• Rabbit anti-Human SMARCC1/BAF155 Monoclonal Antibody

• Synonym:
• HYC5; Rsc8; SRG3; SWI3; BAF155; CRACC1; 55

• Description:
• The antibody against SMARCC1/BAF155 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human SMARCC1/BAF155 (Q92922) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ChIP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human SMARCC1/BAF155 (Q92922).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ChIP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• SMARCC1/BAF155

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGAEEEKMEADPDGQQPEKAENKVENE

• Gene ID:
• 6599

• Uniprot-ID:
• Q92922

• Purification Method:
• HeLa, HepG2, Mouse brain, Mouse testis

• Positive Samples:
• Affinity purification