Rabbit anti-Human SMARCB1/SNF5 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17177P

• Product Name:
• Rabbit anti-Human SMARCB1/SNF5 Monoclonal Antibody

• Synonym:
• RDT; CSS3; INI1; SNF5; Snr1; BAF47; INI-1; MRD15; RTPS1; Sfh1p; hSNFS; SNF5L1; SWNTS1; PPP1R144; F5

• Description:
• The antibody against SMARCB1/SNF5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMARCB1/SNF5 (NP_003064.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• SMARCB1/SNF5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT

• Gene ID:
• 6598

• Uniprot-ID:
• Q12824

• Purification Method:
• 293F, K-562, NIH/3T3, Neuro-2a, Rat testis

• Positive Samples:
• Affinity purification