Rabbit anti-Human SF3B3/SAP130 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14051P

• Product Name:
• Rabbit anti-Human SF3B3/SAP130 Monoclonal Antibody

• Synonym:
• RSE1; SAP130; SF3b130; STAF130; SF3B3/SAP130

• Description:
• The antibody against SF3B3/SAP130 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1101-1217 of human SF3B3/SAP130 (Q15393) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1101-1217 of human SF3B3/SAP130 (Q15393).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• SF3B3/SAP130

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

• Gene ID:
• 23450

• Uniprot-ID:
• Q15393

• Purification Method:
• Hep G2, Mouse testis, Rat lung

• Positive Samples:
• Affinity purification