Rabbit anti-Human CD172a/SIRPα Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14052P

• Product Name:
• Rabbit anti-Human CD172a/SIRPα Monoclonal Antibody

• Synonym:
• BIT; MFR; P84; SIRP; MYD-1; SHPS1; CD172A; PTPNS1; CD172a/SIRPα

• Description:
• The antibody against CD172a/SIRPα was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 395-495 of human CD172a/SIRPα (P78324) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 395-495 of human CD172a/SIRPα (P78324).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD172a/SIRPα

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RIRQKKAQGSTSSTRLHEPEKNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSE

• Gene ID:
• 140885

• Uniprot-ID:
• P78324

• Purification Method:
• THP-1, U-937, RAW264.7, Rat brain

• Positive Samples:
• Affinity purification