Rabbit anti-Human RUNX2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17061P

• Product Name:
• Rabbit anti-Human RUNX2 Monoclonal Antibody

• Synonym:
• CCD; AML3; CCD1; CLCD; OSF2; CBFA1; OSF-2; PEA2aA; PEBP2aA; CBF-alpha-1; RUNX2

• Description:
• The antibody against RUNX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 336-439 of human RUNX2 (Q13950) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 336-439 of human RUNX2 (Q13950).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• RUNX2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQT

• Gene ID:
• 860

• Uniprot-ID:
• Q13950

• Purification Method:
• U2OS, PC-3, U-937, Mouse testis, Mouse thymus

• Positive Samples:
• Affinity purification