Rabbit anti-Human NOX2/gp91phox Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17062P

• Product Name:
• Rabbit anti-Human NOX2/gp91phox Monoclonal Antibody

• Synonym:
• CGD; CGDX; NOX2; IMD34; AMCBX2; GP91-1; GP91PHOX; p91-PHOX; GP91-PHOX; NOX2/gp91phox

• Description:
• The antibody against NOX2/gp91phox was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human NOX2/gp91phox (P04839) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NOX2/gp91phox (P04839).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NOX2/gp91phox

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRS

• Gene ID:
• 1536

• Uniprot-ID:
• P04839

• Purification Method:
• Mouse spleen, Mouse heart, Rat lung, Rat spleen, HepG2, Raji, HL-60, Mouse lung

• Positive Samples:
• Affinity purification