Rabbit anti-Human PSMB9/LMP2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14040P

• Product Name:
• Rabbit anti-Human PSMB9/LMP2 Monoclonal Antibody

• Synonym:
• LMP2; PRAAS3; PSMB6i; RING12; beta1i; PSMB9/LMP2

• Description:
• The antibody against PSMB9/LMP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 125-219 of human PSMB9/LMP2 (P28065) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 125-219 of human PSMB9/LMP2 (P28065).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PSMB9/LMP2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

• Gene ID:
• 5698

• Uniprot-ID:
• P28065

• Purification Method:
• Raji, Mouse lung, Mouse spleen, Mouse thymus, Rat lung, Rat liver, THP-1

• Positive Samples:
• Affinity purification