Rabbit anti-Human LIN28B Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14041P

• Product Name:
• Rabbit anti-Human LIN28B Monoclonal Antibody

• Synonym:
• CSDD2; LIN28B

• Description:
• The antibody against LIN28B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human LIN28B (Q6ZN17) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human LIN28B (Q6ZN17).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• LIN28B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAEGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREGSPLDIPVDVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGSERRPKGKTLQKRKPKGDRCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMVAN

• Gene ID:
• 389421

• Uniprot-ID:
• Q6ZN17

• Purification Method:
• 293T, Hep G2

• Positive Samples:
• Affinity purification