Rabbit anti-Human Podoplanin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15520P

• Product Name:
• Rabbit anti-Human Podoplanin Monoclonal Antibody

• Synonym:
• PDPN; AGGRUS; GP36; GP40; Gp38; HT1A-1; OTS8; PA2.26; T1A; T1A-2; T1A2; TI1A; podoplanin; Podoplanin

• Description:
• The antibody against Podoplanin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-123 of Human Podoplanin(NM_006474.5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 21-123 of Human Podoplanin(NM_006474.5).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Podoplanin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK

• Gene ID:
• 10630

• Uniprot-ID:
• Q86YL7

• Purification Method:
• U-2 OS

• Positive Samples:
• Affinity purification