Rabbit anti-Human KIR2DL2/KIR2DL3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15519P

• Product Name:
• Rabbit anti-Human KIR2DL2/KIR2DL3 Monoclonal Antibody

• Synonym:
• KIR2DL3; CD158B2; CD158b; GL183; KIR-023GB; KIR-K7b; KIR-K7c; KIR2DS5; KIRCL23; NKAT; NKAT2; NKAT2A; NKAT2B; p58; killer cell immunoglobulin-like receptor 2DL3; KIR2DL2/KIR2DL3

• Description:
• The antibody against KIR2DL2/KIR2DL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3(NP_056952.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human KIR2DL3(NP_056952.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• KIR2DL2/KIR2DL3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

• Gene ID:
• 38033804

• Uniprot-ID:
• P43628

• Purification Method:
• 293T transfected with KIR2DL2

• Positive Samples:
• Affinity purification