Rabbit anti-Human PKC delta Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16114P

• Product Name:
• Rabbit anti-Human PKC delta Monoclonal Antibody

• Synonym:
• MAY1; PKCD; ALPS3; CVID9; nPKC-delta; PKC delta

• Description:
• The antibody against PKC delta was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 547-653 of human PKC delta (Q05655) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 547-653 of human PKC delta (Q05655).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PKC delta

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLID

• Gene ID:
• 5580

• Uniprot-ID:
• Q05655

• Purification Method:
• HeLa, NIH/3T3, SH-SY5Y, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification