Rabbit anti-Human ILF3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16115P

• Product Name:
• Rabbit anti-Human ILF3 Monoclonal Antibody

• Synonym:
• CBTF; DRBF; MMP4; MPP4; NF90; NFAR; NF110; NF90a; NF90b; NF90c; NFAR2; TCP80; DRBP76; NF110b; NFAR-1; NFAR-2; NFAR90; TCP110; MPP4110; NF90ctv; NFAR110; MPHOSPH4; NF-AT-90; ILF3

• Description:
• The antibody against ILF3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ILF3 (Q12906) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ILF3 (Q12906).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ILF3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAK

• Gene ID:
• 3609

• Uniprot-ID:
• Q12906

• Purification Method:
• HeLa, Raji, C6, SH-SY5Y, Mouse testis

• Positive Samples:
• Affinity purification