Rabbit anti-Human PDLIM1/CLP36 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14382P

• Product Name:
• Rabbit anti-Human PDLIM1/CLP36 Monoclonal Antibody

• Synonym:
• CLIM1; CLP36; CLP-36; hCLIM1; HEL-S-112; PDLIM1/CLP36

• Description:
• The antibody against PDLIM1/CLP36 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PDLIM1/CLP36 (O00151) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PDLIM1/CLP36 (O00151).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PDLIM1/CLP36

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LQEKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFF

• Gene ID:
• 9124

• Uniprot-ID:
• O00151

• Purification Method:
• BxPC-3, THP-1, Mouse thymus

• Positive Samples:
• Affinity purification