Rabbit anti-Human BAT3/BAG6 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14381P

• Product Name:
• Rabbit anti-Human BAT3/BAG6 Monoclonal Antibody

• Synonym:
• G3; BAT3; BAG-6; D6S52E; BAT3/BAG6

• Description:
• The antibody against BAT3/BAG6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1033-1132 of human BAT3/BAG6 (P46379) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1033-1132 of human BAT3/BAG6 (P46379).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• BAT3/BAG6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQRAFADDP

• Gene ID:
• 7917

• Uniprot-ID:
• P46379

• Purification Method:
• 293T, NIH/3T3, C6, Mouse testis

• Positive Samples:
• Affinity purification