Rabbit anti-Human NOXA2/p67phox Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16036P

• Product Name:
• Rabbit anti-Human NOXA2/p67phox Monoclonal Antibody

• Synonym:
• NCF-2; NOXA2; P67PHOX; P67-PHOX; NOXA2/p67phox

• Description:
• The antibody against NOXA2/p67phox was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NOXA2/p67phox (P19878) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NOXA2/p67phox (P19878).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NOXA2/p67phox

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELR

• Gene ID:
• 4688

• Uniprot-ID:
• P19878

• Purification Method:
• Mouse lung, Rat lung

• Positive Samples:
• Affinity purification