Rabbit anti-Human NDUFA13/GRIM19 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16035P

• Product Name:
• Rabbit anti-Human NDUFA13/GRIM19 Monoclonal Antibody

• Synonym:
• B16.6; CDA016; CGI-39; GRIM19; GRIM-19; MC1DN28; NDUFA13/GRIM19

• Description:
• The antibody against NDUFA13/GRIM19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human NDUFA13/GRIM19 (Q9P0J0) (NP_057049.5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human NDUFA13/GRIM19 (Q9P0J0) (NP_057049.5)

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NDUFA13/GRIM19

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

• Gene ID:
• 51079

• Uniprot-ID:
• Q9P0J0

• Purification Method:
• 293T, HepG2, RD

• Positive Samples:
• Affinity purification