Rabbit anti-Human MYH14 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15950P

• Product Name:
• Rabbit anti-Human MYH14 Monoclonal Antibody

• Synonym:
• DFNA4; MHC16; MYH17; PNMHH; DFNA4A; myosin; FP17425; NMHC II-C; NMHC-II-C; MYH14

• Description:
• The antibody against MYH14 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human MYH14 (NP_079005.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MYH14 (NP_079005.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• MYH14

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNH

• Gene ID:
• 79784

• Uniprot-ID:
• Q7Z406

• Purification Method:
• MCF7, Mouse lung, Rat lung

• Positive Samples:
• Affinity purification