Rabbit anti-Human C/EBPB Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15954P

• Product Name:
• Rabbit anti-Human C/EBPB Monoclonal Antibody

• Synonym:
• TCF5; IL6DBP; NF-IL6; C/EBP-beta; C/EBPB

• Description:
• The antibody against C/EBPB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 246-345 of human C/EBPB (P17676) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 246-345 of human C/EBPB (P17676).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• C/EBPB

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

• Gene ID:
• 1051

• Uniprot-ID:
• P17676

• Purification Method:
• MCF7, HeLa, A-549, 293T, Rat lung, Rat liver

• Positive Samples:
• Affinity purification