Rabbit anti-Human MCCC1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13319P

• Product Name:
• Rabbit anti-Human MCCC1 Monoclonal Antibody

• Synonym:
• MCCA; MCC-B; MCCCalpha; [KD Validated] MCCC1

• Description:
• The antibody against MCCC1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 640-725 of human MCCC1(NP_064551.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 640-725 of human MCCC1(NP_064551.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• MCCC1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFEEEESDKRESE

• Gene ID:
• 56922

• Uniprot-ID:
• Q96RQ3

• Purification Method:
• U-2 OS, Mouse liver, Rat heart, 293T

• Positive Samples:
• Affinity purification