Rabbit anti-Human eIF1A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13320P

• Product Name:
• Rabbit anti-Human eIF1A Monoclonal Antibody

• Synonym:
• EIF1A; EIF4C; eIF-1A; eIF-4C; EIF1AP1; eIF1A

• Description:
• The antibody against eIF1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 65-144 of human eIF1A (P47813) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 65-144 of human eIF1A (P47813).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• eIF1A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

• Gene ID:
• 1964

• Uniprot-ID:
• P47813

• Purification Method:
• HeLa, Mouse liver, Mouse testis, Mouse brain

• Positive Samples:
• Affinity purification