Rabbit anti-Human Ikaros Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14096P

• Product Name:
• Rabbit anti-Human Ikaros Monoclonal Antibody

• Synonym:
• IK1; LYF1; LyF-1; CVID13; IKAROS; PPP1R92; PRO0758; ZNFN1A1; Hs.54452; Ikaros

• Description:
• The antibody against Ikaros was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human Ikaros (Q13422) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ChIP, ELISA, CUT&Tag.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Ikaros (Q13422).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ChIP, ELISA, CUT&Tag

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Ikaros

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQL

• Gene ID:
• 10320

• Uniprot-ID:
• Q13422

• Purification Method:
• HeLa, U-937, Mouse lung

• Positive Samples:
• Affinity purification