Rabbit anti-Human Complement C3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14095P

• Product Name:
• Rabbit anti-Human Complement C3 Monoclonal Antibody

• Synonym:
• ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p; Complement C3

• Description:
• The antibody against Complement C3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Complement Complement C3 (P01024) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Complement Complement C3 (P01024).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Complement C3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQL

• Gene ID:
• 718

• Uniprot-ID:
• P01024

• Purification Method:
• HepG2

• Positive Samples:
• Affinity purification