Rabbit anti-Human GSR Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16465P

• Product Name:
• Rabbit anti-Human GSR Monoclonal Antibody

• Synonym:
• GR; GSRD; HEL-75; HEL-S-122m; GSR

• Description:
• The antibody against GSR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 423-522 of human GSR (P00390) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 423-522 of human GSR (P00390).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• GSR

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR

• Gene ID:
• 2936

• Uniprot-ID:
• P00390

• Purification Method:
• Hep G2, A549, K-562, Mouse liver, Mouse brain, Mouse kidney, Rat lung, Rat liver, Rat kidney

• Positive Samples:
• Affinity purification