Rabbit anti-Human Cyclin H Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16464P

• Product Name:
• Rabbit anti-Human Cyclin H Monoclonal Antibody

• Synonym:
• CAK; p34; p37; CycH; Cyclin H

• Description:
• The antibody against Cyclin H was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 224-323 of human Cyclin H (P51946) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 224-323 of human Cyclin H (P51946).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Cyclin H

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

• Gene ID:
• 902

• Uniprot-ID:
• P51946

• Purification Method:
• HeLa, Hep G2, Jurkat, Mouse testis

• Positive Samples:
• Affinity purification