Rabbit anti-Human GPX4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15636P

• Product Name:
• Rabbit anti-Human GPX4 Monoclonal Antibody

• Synonym:
• MCSP; SMDS; GPx-4; PHGPx; snGPx; GSHPx-4; snPHGPx; [KD Validated] GPX4

• Description:
• The antibody against GPX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 74-197 of human GPX4(NP_002076.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 74-197 of human GPX4(NP_002076.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• GPX4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

• Gene ID:
• 2879

• Uniprot-ID:
• P36969

• Purification Method:
• U-87 MG, Jurkat, U-937, Mouse brain

• Positive Samples:
• Affinity purification