Rabbit anti-Human CD300C Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15635P

• Product Name:
• Rabbit anti-Human CD300C Monoclonal Antibody

• Synonym:
• LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1; CD300C

• Description:
• The antibody against CD300C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-183 of human CD300C (NP_006669.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 21-183 of human CD300C (NP_006669.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD300C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

• Gene ID:
• 10871

• Uniprot-ID:
• Q08708

• Positive Samples:
• Affinity purification