• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human CD300C Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-15635P
  • Product Name:
  • Rabbit anti-Human CD300C Monoclonal Antibody
  • Synonym:
  • LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1; CD300C
  • Description:
  • The antibody against CD300C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-183 of human CD300C (NP_006669.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, FC, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 21-183 of human CD300C (NP_006669.1).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • IF/ICC, FC, ELISA
  • Storage Buffer:
  • PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • CD300C
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
  • Gene ID:
  • 10871
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human CaMKII Monoclonal Antibody-ADA-15634P
  • Online Inquiry

    refresh