Rabbit anti-Human CD70 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14799P

• Product Name:
• Rabbit anti-Human CD70 Monoclonal Antibody

• Synonym:
• CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A; CD70

• Description:
• The antibody against CD70 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 39-193 of human CD70 (P32970) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 39-193 of human CD70 (P32970).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD70

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

• Gene ID:
• 970

• Uniprot-ID:
• P32970

• Purification Method:
• Rat brain

• Positive Samples:
• Affinity purification