Rabbit anti-Human CD69 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14798P

• Product Name:
• Rabbit anti-Human CD69 Monoclonal Antibody

• Synonym:
• AIM; EA1; MLR-3; CLEC2C; GP32/28; BL-AC/P26; CD69

• Description:
• The antibody against CD69 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 62-199 of human CD69 (NP_001772.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 62-199 of human CD69 (NP_001772.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD69

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

• Gene ID:
• 969

• Uniprot-ID:
• Q07108

• Purification Method:
• Rat spleen

• Positive Samples:
• Affinity purification