Rabbit anti-Human CD39/ENTPD1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15649P

• Product Name:
• Rabbit anti-Human CD39/ENTPD1 Monoclonal Antibody

• Synonym:
• CD39; SPG64; ATPDase; NTPDase-1; CD39/ENTPD1

• Description:
• The antibody against CD39/ENTPD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 255-442 of human CD39/ENTPD1 (NP_001767.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 255-442 of human CD39/ENTPD1 (NP_001767.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD39/ENTPD1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• CYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGK

• Gene ID:
• 953

• Uniprot-ID:
• P49961

• Purification Method:
• 293T transfected with CD39/ENTPD1(Human)

• Positive Samples:
• Affinity purification