Rabbit anti-Human CD327/SIGLEC6 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15650P

• Product Name:
• Rabbit anti-Human CD327/SIGLEC6 Monoclonal Antibody

• Synonym:
• CD327; CD33L; OBBP1; CD33L1; CD33L2; CDW327; CD327/SIGLEC6

• Description:
• The antibody against CD327/SIGLEC6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-331 of human CD327/SIGLEC6 (NP_001236.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 27-331 of human CD327/SIGLEC6 (NP_001236.4).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD327/SIGLEC6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQIS

• Gene ID:
• 946

• Uniprot-ID:
• O43699

• Positive Samples:
• Affinity purification