Rabbit anti-Human Annexin A2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15213P

• Product Name:
• Rabbit anti-Human Annexin A2 Monoclonal Antibody

• Synonym:
• P36; ANX2; LIP2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; HEL-S-270; Annexin A2

• Description:
• The antibody against Annexin A2 was raised in Rabbit using the recombinant protein of human Annexin A2 as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of human Annexin A2.

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Annexin A2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVIL

• Gene ID:
• 302

• Uniprot-ID:
• P07355

• Purification Method:
• HeLa, MCF7, LNcap(Low expression control), NIH/3T3

• Positive Samples:
• Affinity purification