Rat Anti-TCF7 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-20150M

• Product Name:
• Rat Anti-TCF7 Monoclonal Antibody

• Formulation:
• Lyophilised:Reconstitute the antibody with 500µl sterile PBS and the final concentration is 200µg/ml.

• Host Species:
• Rat

• Immunogen:
• Recombinant fragment corresponding to Mouse TCF7 AA 61-116. Sequence: GAAAGAGVPGPGVRVHGEAEGAPEALGREHTSQRLFPDKLPESLEDGLKA PECTSG

• Species Reactivity:
• Mouse

• Clone#:
• QL9428-15C8

• Isotype:
• IgG2

• Application:
• WB

• Positive control:
• Mouse thymus tissue lysate.

• Storage Buffer:
• Constituent: 100% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal