• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rat Anti-TCF7 Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-20150M
  • Product Name:
  • Rat Anti-TCF7 Monoclonal Antibody
  • Formulation:
  • Lyophilised:Reconstitute the antibody with 500µl sterile PBS and the final concentration is 200µg/ml.
  • Host Species:
  • Rat
  • Immunogen:
  • Recombinant fragment corresponding to Mouse TCF7 AA 61-116. Sequence: GAAAGAGVPGPGVRVHGEAEGAPEALGREHTSQRLFPDKLPESLEDGLKA PECTSG
  • Species Reactivity:
  • Mouse
  • Clone#:
  • QL9428-15C8
  • Isotype:
  • IgG2
  • Application:
  • WB
  • Positive control:
  • Mouse thymus tissue lysate.
  • Storage Buffer:
  • Constituent: 100% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Clonality:
  • Monoclonal
  • Pre product:Rabbit Anti-BMP4 Monoclonal Antibody-FPA-2014M
  • Online Inquiry

    refresh