Rat Anti-ITLN1 Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-12520M

• Product Name:
• Rat Anti-ITLN1 Monoclonal Antibody

• Formulation:
• Lyophilised:Reconstitute with 500ul sterile PBS to give a final concentration of 200ug/ml.

• Host Species:
• Rat

• Immunogen:
• Recombinant full length protein corresponding to Mouse ITLN1 AA 20-298. This product is for the mature full length protein. The signal peptide and propeptide are not included. Sequence: AEENLDTNRWGNSFFSSLPRSCKEIKQEHTKAQDGLYFLRTKNGVIYQTF CDMTTAGGGWTLVASVHE

• Species Reactivity:
• Mouse

• Clone#:
• QL9342-5F39

• Isotype:
• IgG2

• Application:
• WB

• Positive control:
• Mouse stomach tissue lysate.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal