Cat#:FPA-9785M;Product Name:Rat Anti-gp340 Monoclonal Antibody;Formulation:Lyophilised:Reconstitute the antibody with 500 µl sterile PBS and the final concentration is 200 µg/ml. Reconstituted antibody can also be aliquoted and stored frozen at <-20 for at least for six months without detectable loss of activity. Avoid repeated ;Host Species:Rat ;Immunogen:Recombinant fragment corresponding to Mouse gp340 AA 215-420. Sequence: WDVSDANVVCRQLGCGWAVSAPGNAYFGQGQGPIVLDDVACGGYENYLWS CSHQGWLSHNCGHQEDAGVICSASQSSSPTPGWWNPGGTNNDVFYPTEQT TAGTDSGLAVRLVNGGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQ LGCGWAVSAPGNAYFGPGSGSIVLDDVACT;Species Reactivity:Mouse;Clone#:QL931-6D25;Isotype:IgG2;Application:WB;Positive control:Mouse intestine tissue lysate;Storage Procedures:Store at 4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.;