• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rat Anti-Chordin Monoclonal Antibody Online Inquiry

  • Cat#:
  • FPA-5574M
  • Product Name:
  • Rat Anti-Chordin Monoclonal Antibody
  • Host Species:
  • Rat
  • Immunogen:
  • Recombinant full length protein corresponding to Mouse Chordin AA 27-947. This product is for the mature full length protein from AA 27 to 947. The signal peptide is not included. Sequence: TGPEPPALPIRSEKEPLPVRGAAGCSFGGKVYALDETWHPDLGEPFGVMR CVLCACEAPQ WAR
  • Species Reactivity:
  • Mouse
  • Clone#:
  • QZ2-5A1
  • Isotype:
  • IgG2
  • Application:
  • WB
  • Storage Buffer:
  • Constituent: 100% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Clonality:
  • Monoclonal
  • Form:
  • Liquid
  • Pre product:Mouse Anti-Chondroitin Sulfate Monoclonal Antibody-FPA-5573M
  • Online Inquiry

    refresh