Rat Anti-Chordin Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-5574M

• Product Name:
• Rat Anti-Chordin Monoclonal Antibody

• Host Species:
• Rat

• Immunogen:
• Recombinant full length protein corresponding to Mouse Chordin AA 27-947. This product is for the mature full length protein from AA 27 to 947. The signal peptide is not included. Sequence: TGPEPPALPIRSEKEPLPVRGAAGCSFGGKVYALDETWHPDLGEPFGVMR CVLCACEAPQ WAR

• Species Reactivity:
• Mouse

• Clone#:
• QZ2-5A1

• Isotype:
• IgG2

• Application:
• WB

• Storage Buffer:
• Constituent: 100% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal

• Form:
• Liquid