Rat Anti-AGRP Monoclonal Antibody Online Inquiry

• Cat#:
• FPA-437M

• Product Name:
• Rat Anti-AGRP Monoclonal Antibody

• Host Species:
• Rat

• Immunogen:
• Recombinant fragment corresponding to Mouse AGRP AA 82-130 (C terminal). Sequence: SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSR

• Species Reactivity:
• Mouse Predicted to work with: Cow, Pig

• Clone#:
• 12D13

• Isotype:
• IgG2

• Application:
• WB

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

• Clonality:
• Monoclonal

• Form:
• Liquid