• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Rabbit Polyclonal to TACC1 Online Inquiry

  • Cat#:
  • FPA-34797P
  • Product Name:
  • Rabbit Rabbit Polyclonal to TACC1
  • Host Species:
  • Rabbit Rabbit Polyclonal to TACC1
  • Immunogen:
  • Synthetic peptide corresponding to Human TACC1 aa 11-60 (N terminal). NP_006274.2. Sequence: PVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGN
  • Species Reactivity:
  • Human Predicted to work with: Mouse
  • Isotype:
  • IgG
  • Application:
  • WB, ICC/IF, IHC-P
  • Storage Buffer:
  • pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 0.87% Sodium chloride, 50% Glycerol, 49% PBS PBS (without Mg2+, Ca2+)
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Rabbit Polyclonal to Syntaxin 5A -FPA-34796P
  • Online Inquiry

    refresh