Rabbit Rabbit Polyclonal to TACC1 Online Inquiry

• Cat#:
• FPA-34797P

• Product Name:
• Rabbit Rabbit Polyclonal to TACC1

• Host Species:
• Rabbit Rabbit Polyclonal to TACC1

• Immunogen:
• Synthetic peptide corresponding to Human TACC1 aa 11-60 (N terminal). NP_006274.2. Sequence: PVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGN

• Species Reactivity:
• Human Predicted to work with: Mouse

• Isotype:
• IgG

• Application:
• WB, ICC/IF, IHC-P

• Storage Buffer:
• pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 0.87% Sodium chloride, 50% Glycerol, 49% PBS PBS (without Mg2+, Ca2+)

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid