Cat#:FPA-45856P;Product Name:Rabbit Anti-ZZZ3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide, corresponding to a region within internal sequence aa 577-626 (EREFKNRKRHTRRVKLVFDKVGLPARPKSPLDPKKDGESLSYSMLPLSD G) of Human ZZZ3, AAH35079;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog;Isotype:IgG;Application:WB, ELISA;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide, corresponding to a region within internal sequence aa 577-626 (EREFKNRKRHTRRVKLVFDKVGLPARPKSPLDPKKDGESLSYSMLPLSD G) of Human ZZZ3, AAH35079
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
Isotype:
IgG
Application:
WB, ELISA
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.