• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-ZWINT Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-45838P
  • Product Name:
  • Rabbit Anti-ZWINT Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within C terminal aa 225-277 ( PEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVN LP ) of Human ZWINT (NP_008988.2)
  • Species Reactivity:
  • Human Predicted to work with: Chimpanzee, Macaque monkey
  • Isotype:
  • IgG
  • Application:
  • ICC/IF, IHC-P
  • Storage Buffer:
  • Preservative: 0.09% Sodium Azide Constituents: 0.1% BSA, Tris buffered saline
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-ZWINT Polyclonal Antibody-FPA-45837P
  • Online Inquiry

    refresh