Rabbit Anti-ZWINT Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45838P

• Product Name:
• Rabbit Anti-ZWINT Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within C terminal aa 225-277 ( PEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVN LP ) of Human ZWINT (NP_008988.2)

• Species Reactivity:
• Human Predicted to work with: Chimpanzee, Macaque monkey

• Isotype:
• IgG

• Application:
• ICC/IF, IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium Azide Constituents: 0.1% BSA, Tris buffered saline

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid