Rabbit Anti-ZNF793 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49869P

• Product Name:
• Rabbit Anti-ZNF793 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within aa 288-337 ( CGKAFTQKSHRTEHQRTHTGERPFVCSECGKSFGEKSYLNVHRKMHTGER ) of Human ZNF793 (NP_001013681). Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: None Constituents: 2% Sucrose, PBS

• Clonality:
• Polyclonal

• Form:
• Liquid