Rabbit Anti-ZNF75A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49849P

• Product Name:
• Rabbit Anti-ZNF75A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region from N terminal aa 36-85 ( FVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKLKNDTENHQPVS ) of Human ZNF75A (NP_694573) Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: None Constituents: 2% Sucrose, PBS

• Clonality:
• Polyclonal

• Form:
• Liquid