Rabbit Anti-ZNF736 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49841P

• Product Name:
• Rabbit Anti-ZNF736 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ZNF736 aa 89-138 (N terminal). The exact sequence is proprietary. Sequence: HDIKDSFQKVILRKYGSCDLNNLHLKKDYQSVGNCKGQKSSYNGLHQCLS Database link: B4DX44 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Constituents: 98% PBS, 2% Sucrose

• Clonality:
• Polyclonal

• Form:
• Liquid