Rabbit Anti-ZNF708 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45698P

• Product Name:
• Rabbit Anti-ZNF708 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within C terminal aa 433-482 (ILTKHKVIHTEDKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEECG K) of Human ZNF708, EAW84891

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Drosophila melanogaster, Zebrafish

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid