Cat#:FPA-45680P;Product Name:Rabbit Anti-ZNF687 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human ZNF687 aa 371-442. Sequence: LKLSPATPTSEGPKVVSVQLGDGTRLKGTVLPVATIQNASTAMLMAASVA RKAVVLPGGTATSPKMIAKNVL ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:ICC/IF;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;