Cat#:FPA-45653P;Product Name:Rabbit Anti-ZNF641 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within the internal sequence aa 388-437 (RHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQSPRNSWDRGTSV F) of Human ZNF641, NP_689533;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;
Synthetic peptide corresponding to a region within the internal sequence aa 388-437 (RHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQSPRNSWDRGTSV F) of Human ZNF641, NP_689533
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.