Rabbit Anti-ZNF606 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45634P

• Product Name:
• Rabbit Anti-ZNF606 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide of 14 amino acid residues from the amino terminal region of human ZNF606(WHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVDFTQEEWGQLD LVQRTLY).

• Species Reactivity:
• Human Predicted to work with: Mouse, Dog

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid