Rabbit Anti-ZNF589 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49778P

• Product Name:
• Rabbit Anti-ZNF589 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human ZNF589 aa 311-360 (C terminal). The exact sequence is proprietary. Sequence: SCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKHQRIHTGDKPYVCR Database link: Q86UQ0-2 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Clonality:
• Polyclonal

• Form:
• Liquid