Rabbit Anti-ZNF569 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-49764P

• Product Name:
• Rabbit Anti-ZNF569 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 108-157 ( TEEKGNECQKKFANVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNVK ) of Human ZNF569 (NP_689697). Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Guinea pig, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: None Constituents: 2% Sucrose, PBS

• Clonality:
• Polyclonal

• Form:
• Liquid