Rabbit Anti-ZNF566 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-45601P

• Product Name:
• Rabbit Anti-ZNF566 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal sequence aa 144-193 (FTHEDLPTLSHHPSFTLQQIINSKKKFCASKEYRKTFRHGSQFATHEII H) of human ZNF566 (NP_116227).

• Species Reactivity:
• Human Predicted to work with: Horse, Cow, Pig, Chimpanzee

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid