Cat#:FPA-45599P;Product Name:Rabbit Anti-ZNF565 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within internal sequence aa 432 - 481 ( SQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHPGIKPYECRECG ) of Human ZNF565 (NP_689690) ;Species Reactivity:Human Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within internal sequence aa 432 - 481 ( SQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHPGIKPYECRECG ) of Human ZNF565 (NP_689690)
Species Reactivity:
Human Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.